PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_3C4ECAB6D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 282aa    MW: 31116.1 Da    PI: 6.9335
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_3C4ECAB6D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  Traes_5BL_3C4ECAB6D.1 16 KGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 63
                           79********************************************97 PP

2Myb_DNA-binding475.9e-1569114148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Traes_5BL_3C4ECAB6D.1  69 RGNFTQHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 114
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.9581167IPR017930Myb domain
SuperFamilySSF466892.7E-3013110IPR009057Homeodomain-like
SMARTSM007177.4E-141565IPR001005SANT/Myb domain
PfamPF002492.2E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231770IPR009057Homeodomain-like
CDDcd001671.25E-121863No hitNo description
PROSITE profilePS5129418.95368118IPR017930Myb domain
SMARTSM007173.3E-1368116IPR001005SANT/Myb domain
PfamPF002494.6E-1369114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2471118IPR009057Homeodomain-like
CDDcd001677.55E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRPPCCDNG GASVKKGPWT PEEDIILVSY IQQHGPGNWR SVPENTGLMR CSKSCRLRWT  60
NYLRPGIKRG NFTQHEEGII IHLQALLGNK WAAIASYLPQ RTDNDIKNYW NTHLKKKVKR  120
LQQQTHPADH FFQHTSTATN AAEQTISMNY YNPSSSNLDS AMQAAMGYPE TTTGNVAPAA  180
MAVSKLFQSW MPKAPSPEMA DYKGMVAMQE FQTDREDGAT ASMTSGHRFS SSEILAGRDE  240
AATATTFSVL ENWLLDDMAP GQAAMDGLMD ISAGCCANPI MF